ZNF266 antibody - N-terminal region (ARP35808_P050)
Data Sheet
Product Number ARP35808_P050
Product Page www.avivasysbio.com/znf266-antibody-n-terminal-region-arp35808-p050.html
Product Name ZNF266 antibody - N-terminal region (ARP35808_P050)
Size 100 ul
Gene Symbol ZNF266
Alias Symbols HZF1
Protein Size (# AA) 549 amino acids
Molecular Weight 62kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10781
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 266
Description This is a rabbit polyclonal antibody against ZNF266. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Target Reference Abrink,M., et al., (1995) DNA Cell Biol. 14 (2), 125-136
Description of Target Located on chromosome 19, ZNF266 is part of the Kruppel-related zinc finger gene family.
Blocking Peptide For anti-ZNF266 (ARP35808_P050) antibody is Catalog # AAP35808 (Previous Catalog # AAPP07060)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF266
Complete computational species homology data Anti-ZNF266 (ARP35808_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF266.
Peptide Sequence Synthetic peptide located within the following region: EESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGIQMIGSHNGGE
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Swissprot Id Q14584
Protein Name Zinc finger protein 266
Protein Accession # NP_932175
Purification Affinity Purified
Protein Interactions KRTAP10-3; KRTAP10-7; KRT40; TRIM41; CEP70; MDFI; KRTAP5-9; UBC; CDC37; SPRY2;
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF266.
Nucleotide Accession # NM_198058
Replacement Item This antibody may replace item sc-102199 from Santa Cruz Biotechnology.
CB Replacement sc-102199
Conjugation Options

ARP35808_P050-FITC Conjugated

ARP35808_P050-HRP Conjugated

ARP35808_P050-Biotin Conjugated

Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Cerebellum
Human Cerebellum
Image 2
Human HepG2
WB Suggested Anti-ZNF266 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com