CITED2 Antibody - N-terminal region (ARP35789_P050)

Data Sheet
 
Product Number ARP35789_P050
Product Page www.avivasysbio.com/cited2-antibody-n-terminal-region-arp35789-p050.html
Name CITED2 Antibody - N-terminal region (ARP35789_P050)
Protein Size (# AA) 270 amino acids
Molecular Weight 28kDa
NCBI Gene Id 10370
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2
Alias Symbols ASD8, MRG1, VSD2, MRG-1, P35SRJ
Peptide Sequence Synthetic peptide located within the following region: HIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bai,L. (2007) FEBS Lett. 581 (30), 5904-5910
Description of Target CITED2 belongs to the CITED family. It interferes with the binding of transcription factors HIF-1a and STAT2 to p300/CBP.
Protein Interactions UBC; ELAVL1; EP300; SMAD3; SMAD2; LHX2; HIF1A; TFAP2C; LHX3; CREBBP; TFAP2A; TBP; TFAP2B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CITED2 (ARP35789_P050) antibody
Blocking Peptide For anti-CITED2 (ARP35789_P050) antibody is Catalog # AAP35789 (Previous Catalog # AAPP23572)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CITED2
Uniprot ID Q99967
Protein Name Cbp/p300-interacting transactivator 2
Protein Accession # NP_006070
Purification Affinity Purified
Nucleotide Accession # NM_006079
Tested Species Reactivity Human
Gene Symbol CITED2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Sheep
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%
Image 1
Human Brain
WB Suggested Anti-CITED2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Image 2
Human heart
Rabbit Anti-CITED2 Antibody
Catalog Number: ARP35789_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com