MAGEA9 Antibody - middle region (ARP35768_P050)

• Product Number: ARP35768_P050
• Name: MAGEA9 Antibody - middle region (ARP35768_P050)
• Protein Size (# AA): 315 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 4108
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Melanoma antigen family A, 9
• Alias Symbols: CT1.9, MAGE9
• Peptide Sequence: Synthetic peptide located within the following region: ALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Oehlrich,N., (2005) Int. J. Cancer 117 (2), 256-264
• Description of Target: MAGEA9 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This pseudogene is a member of the cytochrome P450 gene superfamily. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. It is possible that, in rare cases, a combination of two SNPs in this gene may result in an open reading frame encoding a functional enzyme which metabolizes codeine to morphine. This locus is part of a cluster of cytochrome P450 genes on chromosome 22q13.1. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
• Protein Interactions: APPL1; UBC; EGLN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MAGEA9 (ARP35768_P050) antibody is Catalog # AAP35768 (Previous Catalog # AAPP07020)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAGEA9
• Uniprot ID: P43362
• Protein Name: Melanoma-associated antigen 9
• Protein Accession #: NP_005356
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005365
• Tested Species Reactivity: Human
• Gene Symbol: MAGEA9
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 85%; Rat: 85%; Yeast: 77%
• Image 1: Human HT1080
  
  WB Suggested Anti-MAGEA9 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HT1080 cell lysate