Med21 Antibody - N-terminal region (ARP35728_P050)

Data Sheet
 
Product Number ARP35728_P050
Product Page www.avivasysbio.com/med21-antibody-n-terminal-region-arp35728-p050.html
Name Med21 Antibody - N-terminal region (ARP35728_P050)
Protein Size (# AA) 144 amino acids
Molecular Weight 15kDa
Subunit 21
NCBI Gene Id 108098
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mediator complex subunit 21
Alias Symbols Sr, Sur, Srb7, Surb7, D19234, AI449604, D6Ertd782, D6Ertd782e, 0610007L03Rik
Peptide Sequence Synthetic peptide located within the following region: FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Med21 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Protein Interactions Med21; Med6; Aagab; Med7; Mcrs1; Pik3ca; Ltb; Brd2; Nfe2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Med21 (ARP35728_P050) antibody
Blocking Peptide For anti-Med21 (ARP35728_P050) antibody is Catalog # AAP35728
Uniprot ID Q9CQ39
Protein Name Mediator of RNA polymerase II transcription subunit 21
Protein Accession # NP_079591
Purification Affinity Purified
Nucleotide Accession # NM_025315
Tested Species Reactivity Mouse
Gene Symbol Med21
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB, CHIP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Mouse Liver
WB Suggested Anti-Med21 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver
Image 2
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com