Product Number |
ARP35728_P050 |
Product Page |
www.avivasysbio.com/med21-antibody-n-terminal-region-arp35728-p050.html |
Name |
Med21 Antibody - N-terminal region (ARP35728_P050) |
Protein Size (# AA) |
144 amino acids |
Molecular Weight |
15kDa |
Subunit |
21 |
NCBI Gene Id |
108098 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Mediator complex subunit 21 |
Alias Symbols |
Sr, Sur, Srb7, Surb7, D19234, AI449604, D6Ertd782, D6Ertd782e, 0610007L03Rik |
Peptide Sequence |
Synthetic peptide located within the following region: FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Med21 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. |
Protein Interactions |
Med21; Med6; Aagab; Med7; Mcrs1; Pik3ca; Ltb; Brd2; Nfe2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Med21 (ARP35728_P050) antibody |
Blocking Peptide |
For anti-Med21 (ARP35728_P050) antibody is Catalog # AAP35728 |
Uniprot ID |
Q9CQ39 |
Protein Name |
Mediator of RNA polymerase II transcription subunit 21 |
Protein Accession # |
NP_079591 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025315 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Med21 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Application |
WB, CHIP |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Mouse Liver
| WB Suggested Anti-Med21 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Liver |
|
Image 2 | HCT116
| Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site. |
|