EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)

• Product Number: ARP35695_P050-Biotin
• Name: EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)
• Protein Size (# AA): 148 amino acids
• Molecular Weight: 16kDa
• Conjugation: Biotin
• NCBI Gene Id: 8721
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Endothelial differentiation-related factor 1
• Alias Symbols: MBF1, EDF-1, CFAP280
• Peptide Sequence: Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Bolognese,F., Gene 374, 87-95 (2006)
• Description of Target: EDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the tran
• Protein Interactions: MEOX2; UBC; IDH3G; UBE2I; MAPK6; NRL; JUN; CEBPA; NR1H3; NR5A2; PPARG; TBP; TAF1; NR5A1; RXRA; PRKCA; ATF2; CREB1; ATF1; CALM3; CALM1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-EDF1 (ARP35695_P050-Biotin) antibody is Catalog # AAP35695 (Previous Catalog # AAPP23549)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EDF1
• Uniprot ID: O60869
• Protein Name: Endothelial differentiation-related factor 1
• Publications:

  Leidi, M., Mariotti, M. & Maier, J. A. M. Transcriptional coactivator EDF-1 is required for PPARgamma-stimulated adipogenesis. Cell. Mol. Life Sci. 66, 2733-42 (2009). WB, Pig, Rat, Dog, Horse, Guinea pig, Human, Bovine, Mouse, Zebrafish 19554257

  Leidi, M., Mariotti, M. & Maier, J. A. M. The effects of silencing EDF-1 in human endothelial cells. Atherosclerosis 211, 55-60 (2010). WB, Pig, Rat, Dog, Horse, Guinea pig, Human, Bovine, Mouse, Zebrafish 20185128

  Leidi, M., Mariotti, M. & Maier, J. A. M. EDF-1 contributes to the regulation of nitric oxide release in VEGF-treated human endothelial cells. Eur. J. Cell Biol. 89, 654-60 (2010). WB, Pig, Rat, Dog, Horse, Guinea pig, Human, Bovine, Mouse, Zebrafish 20605058

• Protein Accession #: NP_003783
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003792
• Gene Symbol: EDF1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: IF, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: