| Product Number |
ARP35662_P050 |
| Product Page |
www.avivasysbio.com/znf35-antibody-n-terminal-region-arp35662-p050.html |
| Name |
ZNF35 Antibody - N-terminal region (ARP35662_P050) |
| Protein Size (# AA) |
527 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
7584 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
zinc finger protein 35 |
| Alias Symbols |
HF10, HF.10, Zfp105 |
| Peptide Sequence |
Synthetic peptide located within the following region: GQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Description of Target |
ZNF35 may be involved in transcriptional regulation. It is involved in cell differentiation and/or proliferation. |
| Protein Interactions |
APP; CREB1; CDC5L; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF35 (ARP35662_P050) antibody |
| Blocking Peptide |
For anti-ZNF35 (ARP35662_P050) antibody is Catalog # AAP35662 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF35 |
| Uniprot ID |
P13682 |
| Protein Name |
Zinc finger protein 35 |
| Protein Accession # |
XP_005265501 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF35 |
| Predicted Species Reactivity |
Human, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100%; Pig: 86% |
| Image 1 | Human Fetal Kidney
 | Host: Rabbit
Target Name: ZNF35
Sample Type: Fetal Kidney lysates
Antibody Dilution: 1.0ug/ml |
|
|
