SLC18A1 Antibody - middle region (ARP35649_P050)

• Product Number: ARP35649_P050
• Name: SLC18A1 Antibody - middle region (ARP35649_P050)
• Protein Size (# AA): 525 amino acids
• Molecular Weight: 56 kDa
• NCBI Gene Id: 6570
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 18 (vesicular monoamine), member 1
• Alias Symbols: CGAT, VAT1, VMAT1
• Peptide Sequence: Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lohoff,F.W., (er) Neuropsychobiology 57 (1-2), 55-60 (2008) In press
• Description of Target: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazineThe vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A2 (MIM 193001).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SLC18A1 (ARP35649_P050) antibody is Catalog # AAP35649 (Previous Catalog # AAPP07896)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC18A1
• Uniprot ID: P54219
• Protein Name: Chromaffin granule amine transporter
• Protein Accession #: NP_003044
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003053
• Tested Species Reactivity: Human
• Gene Symbol: SLC18A1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 91%; Rat: 86%
• Image 1: Human brain
  
  Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5ug/ml using anti-SLC18A1 antibody (ARP35649_P050)
• Image 2: Human brain
  
  Brain, cortex
• Image 3: Human PANC1 Whole Cell
  
  Host: Rabbit
  Target Name: SLC18A1
  Sample Tissue: Human PANC1 Whole Cell
  Antibody Dilution: 1ug/ml