| Product Number |
ARP35634_T100-FITC |
| Product Page |
www.avivasysbio.com/pitx2-antibody-n-terminal-region-fitc-arp35634-t100-fitc.html |
| Name |
PITX2 Antibody - N-terminal region : FITC (ARP35634_T100-FITC) |
| Protein Size (# AA) |
324 amino acids |
| Molecular Weight |
36kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
5308 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paired-like homeodomain 2 |
| Alias Symbols |
RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, ASGD4, IGDS2, IRID2, Otlx2, RIEG1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Martin,D.M., et al., (2004) Dev. Biol. 267 (1), 93-108 |
| Description of Target |
The PITX2 gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. Mutations in PITX2 are associated with Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis syndrome (IGDS), and sporadic cases of Peters anomaly. This protein is involved in the development of the eye, tooth and abdominal organs. It also acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. |
| Protein Interactions |
LEF1; Hoxa1; WDR5; SMAD3; HDAC1; CTNNB1; ZNHIT3; TRIM25; HERC5; PDLIM1; PITX2; PROP1; KAT5; Pou1f1; MSX2; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-PITX2 (ARP35634_T100-FITC) antibody |
| Blocking Peptide |
For anti-PITX2 (ARP35634_T100-FITC) antibody is Catalog # AAP35634 (Previous Catalog # AAPP07881) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2 |
| Uniprot ID |
Q99697-2 |
| Protein Name |
Pituitary homeobox 2 |
| Publications |
Hatou, S. et al. Functional corneal endothelium derived from corneal stroma stem cells of neural crest origin by retinoic acid and Wnt/?-catenin signaling. Stem Cells Dev. 22, 828-39 (2013). WB, Bovine, Mouse, Pig, Human, Dog, Rabbit, Rat 22974347 |
| Protein Accession # |
NP_000316 |
| Nucleotide Accession # |
NM_000325 |
| Gene Symbol |
PITX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93% |
| Image 1 | |
