CACNA1G Antibody - C - terminal region (ARP35566_P050)

Data Sheet
 
Product Number ARP35566_P050
Product Page www.avivasysbio.com/cacna1g-antibody-c-terminal-region-arp35566-p050.html
Name CACNA1G Antibody - C - terminal region (ARP35566_P050)
Protein Size (# AA) 2171 amino acids
Molecular Weight 241 kDa
Subunit alpha-1G
NCBI Gene Id 8913
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Calcium channel, voltage-dependent, T type, alpha 1G subunit
Alias Symbols NBR13, SCA42, Cav3.1, SCA42ND, Ca(V)T.1
Peptide Sequence Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ogino,S., (2007) J Mol Diagn 9 (3), 305-314
Description of Target Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance. See MIM 601011. Low-voltage-activated calcium channels are referred to as 'T' type because their currents are both tra
Protein Interactions RANBP9; UBQLN4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-CACNA1G (ARP35566_P050) antibody
Blocking Peptide For anti-CACNA1G (ARP35566_P050) antibody is Catalog # AAP35566 (Previous Catalog # AAPP06810)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G
Uniprot ID O43497
Protein Name Voltage-dependent T-type calcium channel subunit alpha-1G
Protein Accession # NP_938202
Purification Affinity Purified
Nucleotide Accession # NM_198388
Tested Species Reactivity Human
Gene Symbol CACNA1G
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Image 1
Human brain
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5ug/ml using anti-CACNA1G antibody (ARP35566_P050)
Image 2
Human Spleen
WB Suggested Anti-CACNA1G Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com