Product Number |
ARP35566_P050 |
Product Page |
www.avivasysbio.com/cacna1g-antibody-c-terminal-region-arp35566-p050.html |
Name |
CACNA1G Antibody - C - terminal region (ARP35566_P050) |
Protein Size (# AA) |
2171 amino acids |
Molecular Weight |
241 kDa |
Subunit |
alpha-1G |
NCBI Gene Id |
8913 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Calcium channel, voltage-dependent, T type, alpha 1G subunit |
Alias Symbols |
NBR13, SCA42, Cav3.1, SCA42ND, Ca(V)T.1 |
Peptide Sequence |
Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ogino,S., (2007) J Mol Diagn 9 (3), 305-314 |
Description of Target |
Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance. See MIM 601011. Low-voltage-activated calcium channels are referred to as 'T' type because their currents are both tra |
Protein Interactions |
RANBP9; UBQLN4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-CACNA1G (ARP35566_P050) antibody |
Blocking Peptide |
For anti-CACNA1G (ARP35566_P050) antibody is Catalog # AAP35566 (Previous Catalog # AAPP06810) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G |
Uniprot ID |
O43497 |
Protein Name |
Voltage-dependent T-type calcium channel subunit alpha-1G |
Protein Accession # |
NP_938202 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_198388 |
Tested Species Reactivity |
Human |
Gene Symbol |
CACNA1G |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
Image 1 | Human brain
| Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5ug/ml using anti-CACNA1G antibody (ARP35566_P050) |
|
Image 2 | Human Spleen
| WB Suggested Anti-CACNA1G Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Spleen |
|