| Product Number |
ARP35532_P050 |
| Product Page |
www.avivasysbio.com/htr3e-antibody-middle-region-arp35532-p050.html |
| Name |
HTR3E Antibody - middle region (ARP35532_P050) |
| Protein Size (# AA) |
471 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
285242 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
5-hydroxytryptamine (serotonin) receptor 3E, ionotropic |
| Alias Symbols |
5-HT3E, 5-HT3-E, 5-HT3c1 |
| Peptide Sequence |
Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Peters,J.A., Biochem. Soc. Trans. 32 (PT3), 547-552 (2004) |
| Description of Target |
HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HTR3E (ARP35532_P050) antibody |
| Other Applications Image 1 Data |
Immunofluorescence -- Dilution: 1.3ug/mL |
| Blocking Peptide |
For anti-HTR3E (ARP35532_P050) antibody is Catalog # AAP35532 (Previous Catalog # AAPP06772) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HTR3E |
| Uniprot ID |
A5X5Y0 |
| Protein Name |
5-hydroxytryptamine receptor 3E |
| Protein Accession # |
NP_872395 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182589 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
HTR3E |
| Predicted Species Reactivity |
Human, Dog, Horse, Rabbit |
| Application |
IF, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Horse: 83%; Human: 100%; Rabbit: 83% |
| Image 1 | Mouse Spinal Cord
 | Immunofluorescence -- Dilution: 1.3ug/mL |
|
| Image 2 | Human heart
 | WB Suggested Anti-HTR3E Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
