| Product Number |
ARP35504_T100-FITC |
| Product Page |
www.avivasysbio.com/clcn3-antibody-c-terminal-region-fitc-arp35504-t100-fitc.html |
| Name |
CLCN3 Antibody - C-terminal region : FITC (ARP35504_T100-FITC) |
| Protein Size (# AA) |
866 amino acids |
| Molecular Weight |
95kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
1182 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chloride channel, voltage-sensitive 3 |
| Alias Symbols |
CLC3, ClC-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Salazar,G., et al., (2004) J. Biol. Chem. 279 (24), 25430-25439 |
| Description of Target |
CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator). |
| Protein Interactions |
GOPC; SLC9A3R1; PDZK1; CLCN3; CFTR; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CLCN3 (ARP35504_T100-FITC) antibody |
| Blocking Peptide |
For anti-CLCN3 (ARP35504_T100-FITC) antibody is Catalog # AAP35504 (Previous Catalog # AAPP06744) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3 |
| Uniprot ID |
P51790 |
| Protein Name |
H(+)/Cl(-) exchange transporter 3 |
| Publications |
Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). WB, Zebrafish, Human, Dog, Mouse, Bovine, Pig, Horse, Rabbit, Guinea pig, Rat, Sheep 21050068 |
| Protein Accession # |
NP_776297 |
| Nucleotide Accession # |
NM_173872 |
| Gene Symbol |
CLCN3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Zebrafish: 100% |
| Image 1 | |
