KCNIP2 Antibody - middle region (ARP35490_P050)

Data Sheet
 
Product Number ARP35490_P050
Product Page www.avivasysbio.com/kcnip2-antibody-middle-region-arp35490-p050.html
Name KCNIP2 Antibody - middle region (ARP35490_P050)
Protein Size (# AA) 270 amino acids
Molecular Weight 31kDa
NCBI Gene Id 30819
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Kv channel interacting protein 2
Alias Symbols KCHIP2
Peptide Sequence Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Han,W., (2006) J. Biol. Chem. 281 (37), 27134-27144
Description of Target The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Protein Interactions KCND2; KCNIP1; KCNIP2; KCNE4; KCND3; KCNIP4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNIP2 (ARP35490_P050) antibody
Blocking Peptide For anti-KCNIP2 (ARP35490_P050) antibody is Catalog # AAP35490 (Previous Catalog # AAPP07285)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNIP2
Uniprot ID Q9NS61
Protein Name Kv channel-interacting protein 2
Protein Accession # NP_775283
Purification Affinity Purified
Nucleotide Accession # NM_173191
Tested Species Reactivity Human
Gene Symbol KCNIP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Stomach
WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com