| Product Number |
ARP35455_T100 |
| Product Page |
www.avivasysbio.com/catsper2-antibody-n-terminal-region-arp35455-t100.html |
| Name |
CATSPER2 Antibody - N-terminal region (ARP35455_T100) |
| Protein Size (# AA) |
414 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
117155 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Cation channel, sperm associated 2 |
| Peptide Sequence |
Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Quill,T.A., et al., (2001) Natl. Acad. Sci. U.S.A. 98 (22), 12527-12531 |
| Description of Target |
Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CATSPER2 (ARP35455_T100) antibody |
| Blocking Peptide |
For anti-CATSPER2 (ARP35455_T100) antibody is Catalog # AAP35455 (Previous Catalog # AAPP06692) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CATSPER2 |
| Uniprot ID |
Q96P54 |
| Protein Name |
Cation channel sperm-associated protein 2 |
| Publications |
Kawano, N. et al. Seminal vesicle protein SVS2 is required for sperm survival in the uterus. Proc. Natl. Acad. Sci. U. S. A. 111, 4145-50 (2014). 24591616 |
| Sample Type Confirmation |
CATSPER2 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_742094 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_172096 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CATSPER2 |
| Predicted Species Reactivity |
Human, Cow, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 100% |
| Image 1 | Human Brain
 | Human Brain |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-CATSPER2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateCATSPER2 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
