GABRE Antibody - middle region (ARP35342_P050)

Data Sheet
 
Product Number ARP35342_P050
Product Page www.avivasysbio.com/gabre-antibody-middle-region-arp35342-p050.html
Name GABRE Antibody - middle region (ARP35342_P050)
Protein Size (# AA) 393 amino acids
Molecular Weight 43kDa
Subunit epsilon
NCBI Gene Id 2564
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, epsilon
Peptide Sequence Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sinkkonen,S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595
Description of Target GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABRE (ARP35342_P050) antibody
Blocking Peptide For anti-GABRE (ARP35342_P050) antibody is Catalog # AAP35342 (Previous Catalog # AAPP06577)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GABRE
Uniprot ID P78334
Publications

Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. Expression of GABAA a2-, beta1- and e-receptors are altered significantly in the lateral cerebellum of subjects with schizophrenia, major depression and bipolar disorder. Transl. Psychiatry 3, e303 (2013). 24022508

Hengen, K. B. et al. Increased GABA(A) receptor e-subunit expression on ventral respiratory column neurons protects breathing during pregnancy. PLoS One 7, e30608 (2012). 22303446

Hengen, K. B., Gomez, T. M., Stang, K. M., Johnson, S. M. & Behan, M. Changes in ventral respiratory column GABAaR e- and d-subunits during hibernation mediate resistance to depression by EtOH and pentobarbital. Am. J. Physiol. Regul. Integr. Comp. Physiol. 300, R272-83 (2011). 21084677

Protein Accession # NP_068819
Purification Affinity Purified
Nucleotide Accession # NM_021984
Tested Species Reactivity Human
Gene Symbol GABRE
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 79%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 92%
Image 1
Human Placenta
WB Suggested Anti-GABRE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
Image 2
Human 786-0 Whole Cell
Host: Rabbit
Target Name: GABRE
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com