| Product Number |
ARP35334_T100-FITC |
| Product Page |
www.avivasysbio.com/clcn6-antibody-c-terminal-region-fitc-arp35334-t100-fitc.html |
| Name |
CLCN6 Antibody - C-terminal region : FITC (ARP35334_T100-FITC) |
| Protein Size (# AA) |
353 amino acids |
| Molecular Weight |
39kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
1185 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chloride channel, voltage-sensitive 6 |
| Alias Symbols |
CLC-6, CONRIBA |
| Peptide Sequence |
Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Tran,P., et al., (2002) Mamm. Genome 13 (9), 483-492 |
| Description of Target |
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB. |
| Protein Interactions |
UBC; PPP2R1A; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CLCN6 (ARP35334_T100-FITC) antibody |
| Blocking Peptide |
For anti-CLCN6 (ARP35334_T100-FITC) antibody is Catalog # AAP35334 (Previous Catalog # AAPP07254) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLCN6 |
| Uniprot ID |
Q5SNX3 |
| Protein Name |
Chloride transport protein 6 |
| Publications |
Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). WB, Mouse, Rat, Bovine, Dog, Pig, Horse, Rabbit, Guinea pig, Human 21050068 |
| Protein Accession # |
NP_068504 |
| Nucleotide Accession # |
NM_021736 |
| Gene Symbol |
CLCN6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | |
|
