CLCN6 Antibody - C-terminal region (ARP35334_T100)

• Product Number: ARP35334_T100
• Name: CLCN6 Antibody - C-terminal region (ARP35334_T100)
• Protein Size (# AA): 353 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 1185
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Chloride channel, voltage-sensitive 6
• Alias Symbols: CLC-6, CONRIBA
• Peptide Sequence: Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Tran,P., et al., (2002) Mamm. Genome 13 (9), 483-492
• Description of Target: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.
• Protein Interactions: UBC; PPP2R1A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLCN6 (ARP35334_T100) antibody is Catalog # AAP35334 (Previous Catalog # AAPP07254)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLCN6
• Uniprot ID: Q5SNX3
• Protein Name: Chloride transport protein 6
• Publications:

  Jensen, V. K. et al. A quantitative assay for lysosomal acidification rates in human osteoclasts. Assay Drug Dev. Technol. 9, 157-64 (2011). 21050068

• Protein Accession #: NP_068504
• Purification: Protein A purified
• Nucleotide Accession #: NM_021736
• Tested Species Reactivity: Human
• Gene Symbol: CLCN6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CLCN6 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate
• Image 2: Human NT-2, Mouse WT brain
  
  Lanes:
  1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)
  Primary Antibody Dilution:
  2ug/ml
  Secondary Antibody:
  IRDye 800CW goat anti-rabbit from Li-COR Bioscience
  Secondary Antibody Dilution:
  1: 20,000
  Gene Name:
  CLCN6
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science