| Product Number |
ARP35266_P050 |
| Product Page |
www.avivasysbio.com/chrna9-antibody-n-terminal-region-arp35266-p050.html |
| Name |
CHRNA9 Antibody - N-terminal region (ARP35266_P050) |
| Protein Size (# AA) |
479 amino acids |
| Molecular Weight |
52 kDa |
| NCBI Gene Id |
55584 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cholinergic receptor, nicotinic, alpha 9 (neuronal) |
| Alias Symbols |
NACHRA9, HSA243342 |
| Peptide Sequence |
Synthetic peptide located within the following region: NWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Description of Target |
This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. |
| Protein Interactions |
UBC; Rapsn; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHRNA9 (ARP35266_P050) antibody |
| Blocking Peptide |
For Anti-CHRNA9 antibody is Catalog # AAP35266 |
| Immunogen |
The immunogen for Anti-CHRNA9 antibody is: synthetic peptide directed towards the N-terminal region of Human ACHA9 |
| Uniprot ID |
Q9UGM1 |
| Protein Name |
Neuronal acetylcholine receptor subunit alpha-9 |
| Protein Accession # |
NP_060051.2 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHRNA9 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human MCF7 Whole Cell
 | WB Suggested Anti-ACHA9 antibody Titration: 1 ug/mL
Sample Type: Human MCF7 Whole Cell |
|
|
