CLIC5 Antibody - C-terminal region (ARP35263_P050)

• Product Number: ARP35263_P050
• Name: CLIC5 Antibody - C-terminal region (ARP35263_P050)
• Protein Size (# AA): 251 amino acids
• Molecular Weight: 28 kDa
• NCBI Gene Id: 53405
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chloride intracellular channel 5
• Description:
  View product citations for CLIC5 Antibody - C-terminal region (ARP35263_P050) on CiteAb
• Alias Symbols: MST130, DFNB102, DFNB103, MSTP130
• Peptide Sequence: Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Berryman,M., et al., (2004) J. Biol. Chem. 279 (33), 34794-34801
• Description of Target: Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.
• Protein Interactions: SRPK1; FN1; IQGAP1; GSN; EZR; ACTA1; ACTN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-CLIC5 (ARP35263_P050) antibody is Catalog # AAP35263 (Previous Catalog # AAPP06501)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC5
• Uniprot ID: Q53G01
• Protein Name: Chloride intracellular channel 5 variant EMBL BAD96850.1
• Publications:

  The chloride intracellular channel 5A stimulates podocyte Rac1, protecting against hypertension-induced glomerular injury. Kidney Int. 89, 833-47 (2016). 26924049

• Sample Type Confirmation:

  There is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat

• Protein Accession #: NP_058625
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016929
• Tested Species Reactivity: Human
• Gene Symbol: CLIC5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human Heart
  
  Human Heart
• Image 2: Human Jurkat
  
  WB Suggested Anti-CLIC5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat