| Product Number |
ARP35262_T100 |
| Product Page |
www.avivasysbio.com/clic5-antibody-middle-region-arp35262-t100.html |
| Name |
CLIC5 Antibody - middle region (ARP35262_T100) |
| Protein Size (# AA) |
410 amino acids |
| Molecular Weight |
47 kDa |
| NCBI Gene Id |
53405 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Chloride intracellular channel 5 |
| Alias Symbols |
MST130, DFNB102, DFNB103, MSTP130 |
| Peptide Sequence |
Synthetic peptide located within the following region: HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Berryman,M., et al., (2004) J. Biol. Chem. 279(33):34794-801 |
| Description of Target |
CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. CLIon Channel-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton. |
| Protein Interactions |
SRPK1; FN1; IQGAP1; GSN; EZR; ACTA1; ACTN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-CLIC5 (ARP35262_T100) antibody |
| Blocking Peptide |
For anti-CLIC5 (ARP35262_T100) antibody is Catalog # AAP35262 (Previous Catalog # AAPP06496) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CLIC5 |
| Uniprot ID |
Q9NZA1 |
| Protein Name |
Chloride intracellular channel protein 5 |
| Publications |
Li, F.-N. et al. Chloride intracellular channel 5 modulates adipocyte accumulation in skeletal muscle by inhibiting preadipocyte differentiation. J. Cell. Biochem. 110, 1013-21 (2010). 20564201 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat |
| Purification |
Protein A purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLIC5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human Intestine
 | Human Intestine |
|
| Image 2 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
