| Product Number |
ARP35186_P050 |
| Product Page |
www.avivasysbio.com/htr3b-antibody-n-terminal-region-arp35186-p050.html |
| Name |
HTR3B Antibody - N-terminal region (ARP35186_P050) |
| Protein Size (# AA) |
441 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
9177 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
5-hydroxytryptamine (serotonin) receptor 3B, ionotropic |
| Alias Symbols |
5-HT3B |
| Peptide Sequence |
Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Michel,K., et al., (2005) Gastroenterology. 128(5), 1317-26 |
| Description of Target |
The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HTR3B (ARP35186_P050) antibody |
| Blocking Peptide |
For anti-HTR3B (ARP35186_P050) antibody is Catalog # AAP35186 (Previous Catalog # AAPP06421) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3B |
| Uniprot ID |
O95264 |
| Protein Name |
5-hydroxytryptamine receptor 3B |
| Protein Accession # |
NP_006019 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006028 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
HTR3B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Application |
IF, IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 77%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 86%; Rabbit: 86%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-HTR3B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
| Image 2 | Mouse Spinal Cord
 | Sample Type : Spinal Cord, ventral horns
|
|
| Image 3 | Human Spleen
 | Rabbit Anti-HTR3B Antibody
Catalog Number: ARP35186
Paraffin Embedded Tissue: Human Spleen
Cellular Data: Spleen cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
