Product Number |
ARP35094_T100 |
Product Page |
www.avivasysbio.com/kcnn2-antibody-c-terminal-region-arp35094-t100.html |
Name |
KCNN2 Antibody - C-terminal region (ARP35094_T100) |
Protein Size (# AA) |
579 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
3781 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 |
Alias Symbols |
SK2, hSK2, SKCA2, KCa2.2, SKCa 2 |
Peptide Sequence |
Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Feranchak,A.P., et al., (2004) Gastroenterology 127 (3), 903-913 |
Description of Target |
Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes. |
Protein Interactions |
SRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
|
Datasheets/Manuals |
Printable datasheet for anti-KCNN2 (ARP35094_T100) antibody |
Blocking Peptide |
For anti-KCNN2 (ARP35094_T100) antibody is Catalog # AAP35094 (Previous Catalog # AAPP06325) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2 |
Uniprot ID |
Q9H2S1 |
Protein Name |
Small conductance calcium-activated potassium channel protein 2 |
Publications |
Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimerâs disease mice. J. Neurosci. 32, 8341-53 (2012). 22699914 |
Protein Accession # |
NP_067627 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_021614 |
Tested Species Reactivity |
Human, Rat, Monkey |
Gene Symbol |
KCNN2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish, Monkey |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 93% |
Image 1 | Rat brain section
| Lanes: Rat brain section Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine Secondary Antibody Dilution: 1:500 Gene Name: KCNN2 Submitted by: Dr. Amiel Rosenkranz, Rosalind Franklin University
|
|
Image 2 | Rhesus macaque spinal cord
| Sample Type: Rhesus macaque spinal cordPrimary Antibody Dilution: 1:300Secondary Antibody: Donkey anti Rabbit 488Secondary Antibody Dilution: 1:500Color/Signal Descriptions: Green: KCNN2Gene Name: KCNN2Submitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School |
|
Image 3 | Human liver, 293T
| Host: Rabbit Target: KCNN2 Positive control (+): Human liver (LI) Negative control (-): 293T (2T) Antibody concentration: 0.5ug/ml |
|
Image 4 | Human Fetal Liver
| Host: Rabbit Target Name: KCNN2 Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|