GABRR2 Antibody - middle region (ARP35060_P050)

• Product Number: ARP35060_P050
• Name: GABRR2 Antibody - middle region (ARP35060_P050)
• Protein Size (# AA): 490 amino acids
• Molecular Weight: 54kDa
• Subunit: rho-2
• NCBI Gene Id: 2570
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Gamma-aminobutyric acid (GABA) A receptor, rho 2
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Cavalleri,G.L., (2007) Lancet Neurol 6 (11), 970-980
• Description of Target: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 BX490975.1 60-89 31-1586 BC130352.1 1-1556 1587-1631 M86868.1 1584-1628
• Protein Interactions: GABRR1; SQSTM1; PRKCA; MAP1B; CSNK2A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GABRR2 (ARP35060_P050) antibody is Catalog # AAP35060 (Previous Catalog # AAPP06287)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABRR2
• Uniprot ID: P28476
• Protein Name: Gamma-aminobutyric acid receptor subunit rho-2
• Publications:

  Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). 23778581

• Sample Type Confirmation:

  GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_002034
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002043
• Tested Species Reactivity: Human
• Gene Symbol: GABRR2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Image 1: Human HeLa
  
  WB Suggested Anti-GABRR2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Hela cell lysate
• Image 2: heart
  
  Rabbit Anti-GABRR2 Antibody
  Catalog Number: ARP35060_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
  Observed Staining: Membrane(tight junctions - intercalated disks)
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy2/3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5-2.0 sec
  Protocol located in Reviews and Data.
• Image 3: Human Fetal Brain
  
  Host: Rabbit
  Target Name: GABRR2
  Sample Type: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Liver
  
  Host: Rabbit
  Target Name: GABRR2
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 5: Human 293T
  
  Host: Rabbit
  Target Name: GABRR2
  Sample Type: 293T
  Antibody Dilution: 1.0ug/mlGABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T