GABRR1 Antibody - N-terminal region (ARP35058_P050)

Data Sheet
 
Product Number ARP35058_P050
Product Page www.avivasysbio.com/gabrr1-antibody-n-terminal-region-arp35058-p050.html
Name GABRR1 Antibody - N-terminal region (ARP35058_P050)
Protein Size (# AA) 473 amino acids
Molecular Weight 55kDa
Subunit rho-1
NCBI Gene Id 2569
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, rho 1
Description
Alias Symbols MGC163216
Peptide Sequence Synthetic peptide located within the following region: EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jansen,M., (2008) J. Gen. Physiol. 131 (2), 137-146
Description of Target GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions UBC; FEZF1; IP6K2; DNM1L; TAX1BP1; GABRR1; BCR; Camk2n1; Prkcg; Mapk3; PRKACA; PRKG1; CSNK2A1; P2RX2; GABRR2; SQSTM1; SLC6A9; PRKCA; MAPK1; MAP1B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABRR1 (ARP35058_P050) antibody
Blocking Peptide For anti-GABRR1 (ARP35058_P050) antibody is Catalog # AAP35058 (Previous Catalog # AAPP06285)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GABRR1
Uniprot ID P24046
Protein Name Gamma-aminobutyric acid receptor subunit rho-1
Protein Accession # NP_002033
Purification Affinity Purified
Nucleotide Accession # NM_002042
Tested Species Reactivity Human
Gene Symbol GABRR1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 83%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%; Zebrafish: 83%
Image 1
Human HeLa
WB Suggested Anti-GABRR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com