| Product Number |
ARP34981_T100 |
| Product Page |
www.avivasysbio.com/gabra3-antibody-middle-region-arp34981-t100.html |
| Name |
GABRA3 Antibody - middle region (ARP34981_T100) |
| Protein Size (# AA) |
492 amino acids |
| Molecular Weight |
55 kDa |
| Subunit |
alpha-3 |
| NCBI Gene Id |
2556 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, alpha 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Chou,K.C. et al., (2004) Biochem. Biophys. Res. Commun. 316 (3), 636-642 |
| Description of Target |
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. |
| Protein Interactions |
SDCBP2; UGT2B7; UBQLN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-GABRA3 (ARP34981_T100) antibody |
| Blocking Peptide |
For anti-GABRA3 (ARP34981_T100) antibody is Catalog # AAP34981 (Previous Catalog # AAPP06208) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GABRA3 |
| Uniprot ID |
P34903 |
| Protein Name |
Gamma-aminobutyric acid receptor subunit alpha-3 |
| Protein Accession # |
NP_000799 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000808 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
GABRA3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse bulbus
 | Mouse bulbus |
| | Image 2 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.
|
|
|
