GABRA3 antibody - middle region (ARP34981_T100)
Data Sheet
Product Number ARP34981_T100
Product Page
Product Name GABRA3 antibody - middle region (ARP34981_T100)
Size 100 ul
Gene Symbol GABRA3
Protein Size (# AA) 492 amino acids
Molecular Weight 55kDa
Subunit alpha-3
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 2556
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, alpha 3
Description This is a rabbit polyclonal antibody against GABRA3. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
Target Reference Chou,K.C. et al., (2004) Biochem. Biophys. Res. Commun. 316 (3), 636-642
Description of Target GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Protein Interactions SDCBP2; UGT2B7; UBQLN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-GABRA3 (ARP34981_T100) antibody is Catalog # AAP34981 (Previous Catalog # AAPP06208)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GABRA3
Complete computational species homology data Anti-GABRA3 (ARP34981_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GABRA3.
Swissprot Id P34903
Protein Name Gamma-aminobutyric acid receptor subunit alpha-3
Protein Accession # NP_000799
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GABRA3.
Nucleotide Accession # NM_000808
Replacement Item This antibody may replace item sc-133603, HPA000839
Conjugation Options

ARP34981_T100-FITC Conjugated

ARP34981_T100-HRP Conjugated

ARP34981_T100-Biotin Conjugated

CB Replacement sc-133603; sc-292664; sc-31410; sc-31411; sc-367065; sc-42429; sc-42430; sc-7349; sc-7350; sc-7352; sc-7353; sc-7356; HPA000839
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
mouse bulbus
mouse bulbus
Image 2
Human Jurkat
WB Suggested Anti-GABRA3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 |