Product Number |
ARP34981_T100 |
Product Page |
www.avivasysbio.com/gabra3-antibody-middle-region-arp34981-t100.html |
Name |
GABRA3 Antibody - middle region (ARP34981_T100) |
Protein Size (# AA) |
492 amino acids |
Molecular Weight |
55 kDa |
Subunit |
alpha-3 |
NCBI Gene Id |
2556 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, alpha 3 |
Peptide Sequence |
Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chou,K.C. et al., (2004) Biochem. Biophys. Res. Commun. 316 (3), 636-642 |
Description of Target |
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. |
Protein Interactions |
SDCBP2; UGT2B7; UBQLN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-GABRA3 (ARP34981_T100) antibody |
Blocking Peptide |
For anti-GABRA3 (ARP34981_T100) antibody is Catalog # AAP34981 (Previous Catalog # AAPP06208) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GABRA3 |
Uniprot ID |
P34903 |
Protein Name |
Gamma-aminobutyric acid receptor subunit alpha-3 |
Protein Accession # |
NP_000799 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000808 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
GABRA3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse bulbus
| Mouse bulbus |
| Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.
|
|
|