CHRNA4 Antibody - N-terminal region (ARP34965_P050)

• Product Number: ARP34965_P050
• Name: CHRNA4 Antibody - N-terminal region (ARP34965_P050)
• Protein Size (# AA): 627 amino acids
• Molecular Weight: 67kDa
• Subunit: alpha-4
• NCBI Gene Id: 1137
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cholinergic receptor, nicotinic, alpha 4 (neuronal)
• Alias Symbols: EBN, BFNC, EBN1, NACHR, NACRA4, NACHRA4
• Peptide Sequence: Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fedi,M., (2008) J. Clin. Endocrinol. Metab. 93 (2), 634-637
• Description of Target: CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: Ubqln1; CSNK2B; VSNL1; CHRNB4; CHRNB2; YWHAH; CRELD2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CHRNA4 (ARP34965_P050) antibody is Catalog # AAP34965 (Previous Catalog # AAPP06188)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA4
• Uniprot ID: P43681
• Protein Name: Neuronal acetylcholine receptor subunit alpha-4
• Publications:

  Ishizuka, T., Ozawa, A., Goshima, H. & Watanabe, Y. Involvement of nicotinic acetylcholine receptor in the proliferation of mouse induced pluripotent stem cells. Life Sci. 90, 637-48 (2012). 22483693

• Protein Accession #: NP_000735
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000744
• Tested Species Reactivity: Human
• Gene Symbol: CHRNA4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
• Image 1: Human HepG2
  
  WB Suggested Anti-CHRNA4 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate