CACNB3 Antibody - N-terminal region (ARP34958_P050)

Data Sheet
 
Product Number ARP34958_P050
Product Page www.avivasysbio.com/cacnb3-antibody-n-terminal-region-arp34958-p050.html
Name CACNB3 Antibody - N-terminal region (ARP34958_P050)
Protein Size (# AA) 447 amino acids
Molecular Weight 49kDa
Subunit beta-3
NCBI Gene Id 784
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Calcium channel, voltage-dependent, beta 3 subunit
Alias Symbols CAB3, CACNLB3
Peptide Sequence Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Protein Interactions FASLG; CACNA1C;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CACNB3 (ARP34958_P050) antibody
Blocking Peptide For anti-CACNB3 (ARP34958_P050) antibody is Catalog # AAP34958 (Previous Catalog # AAPP06181)
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human CACNB3
Uniprot ID P54284
Protein Name Voltage-dependent L-type calcium channel subunit beta-3
Sample Type Confirmation

CACNB3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # CAA54056
Purification Affinity Purified
Nucleotide Accession # NM_000725
Tested Species Reactivity Human
Gene Symbol CACNB3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateCACNB3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com