SCN5A Antibody - N-terminal region (ARP34934_P050)

Data Sheet
 
Product Number ARP34934_P050
Product Page www.avivasysbio.com/scn5a-antibody-n-terminal-region-arp34934-p050.html
Name SCN5A Antibody - N-terminal region (ARP34934_P050)
Protein Size (# AA) 2015 amino acids
Molecular Weight 227kDa
Subunit alpha
NCBI Gene Id 6331
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sodium channel, voltage-gated, type V, alpha subunit
Alias Symbols HB1, HB2, HH1, IVF, VF1, HBBD, ICCD, LQT3, SSS1, CDCD2, CMD1E, CMPD2, PFHB1, Nav1.5
Peptide Sequence Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Van (2008) Heart Rhythm 5 (5), 712-715
Description of Target SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in several transcript variants encoding different isoforms.
Protein Interactions CALM1; CAV3; ALB; Nedd4; WWP2; UBC; SNTG2; NEDD4L; DLG2; INADL; DLG4; RGS3; SNTA1; DLG1; RGS2; SCN5A; SNTB2; SNTB1; DLG3; CBL;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SCN5A (ARP34934_P050) antibody
Blocking Peptide For anti-SCN5A (ARP34934_P050) antibody is Catalog # AAP34934 (Previous Catalog # AAPP06157)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SCN5A
Uniprot ID Q14524
Protein Name Sodium channel protein type 5 subunit alpha
Publications

Matsushita, N. et al. Nicorandil improves electrical remodelling, leading to the prevention of electrically induced ventricular tachyarrhythmia in a mouse model of desmin-related cardiomyopathy. Clin. Exp. Pharmacol. Physiol. 41, 89-97 (2014). 24117876

Protein Accession # NP_000326
Purification Affinity Purified
Nucleotide Accession # NM_000335
Tested Species Reactivity Human
Gene Symbol SCN5A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human Fetal Muscle
Host: Rabbit
Target Name: SCN5A
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml
Image 2
heart
Rabbit Anti-SCN5A Antibody
Catalog Number: ARP34934_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Membrane
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
Image 3
Human Muscle
WB Suggested Anti-SCN5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com