Product Number |
ARP34924_P050 |
Product Page |
www.avivasysbio.com/kcnq1-antibody-n-terminal-region-arp34924-p050.html |
Name |
KCNQ1 Antibody - N-terminal region (ARP34924_P050) |
Protein Size (# AA) |
676 amino acids |
Molecular Weight |
75 kDa |
NCBI Gene Id |
3784 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Potassium voltage-gated channel, KQT-like subfamily, member 1 |
Alias Symbols |
LQT, RWS, WRS, LQT1, SQT2, ATFB1, ATFB3, JLNS1, KCNA8, KCNA9, Kv1.9, Kv7.1, KVLQT1 |
Peptide Sequence |
Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Alternative splicing results in at least two transcript variants encoding distinct isoforms. |
Protein Interactions |
ATP4A; NEDD4L; AP2M1; USP2; UBC; NEDD4; PRKACA; KCNE1; HSPA4; KCNE4; AKAP9; KCNE2; TRAF6; KCNQ2; PRKAR2A; PPP1CA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNQ1 (ARP34924_P050) antibody |
Additional Information |
IHC Information: Kidney |
Blocking Peptide |
For anti-KCNQ1 (ARP34924_P050) antibody is Catalog # AAP34924 (Previous Catalog # AAPP06102) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1 |
Uniprot ID |
P51787 |
Publications |
Zhou, S. et al. Antiarrhythmic effects of beta3-adrenergic receptor stimulation in a canine model of ventricular tachycardia. Heart Rhythm 5, 289-97 (2008). 18242556 |
Protein Accession # |
NP_861462 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_181797 |
Tested Species Reactivity |
Human, Mouse, Hamster |
Gene Symbol |
KCNQ1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Hamster
| Lanes: 100 ug CHO cell lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1:25000 Gene Name: KCNQ1 Submitted by: Anonymous
|
|
Image 2 | Human Kidney
| Kidney |
|
Image 3 | Human Liver
| WB Suggested Anti-KCNQ1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Liver |
|
Image 4 | Mouse Brain
| Host: Mouse Target Name: KCNQ1 Sample Tissue: Mouse Brain Antibody Dilution: 1ug/ml |
|