FOXK2 Antibody - C-terminal region (ARP34875_P050)

• Product Number: ARP34875_P050
• Name: FOXK2 Antibody - C-terminal region (ARP34875_P050)
• Protein Size (# AA): 328 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 3607
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Forkhead box K2
• Alias Symbols: ILF, ILF1, ILF-1, nGTBP
• Peptide Sequence: Synthetic peptide located within the following region: KQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKAP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
• Protein Interactions: HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXK2 (ARP34875_P050) antibody is Catalog # AAP34875
• Uniprot ID: Q01167-3
• Protein Name: Forkhead box protein K2
• Sample Type Confirmation:

  FOXK2 is supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_852096
• Purification: Affinity Purified
• Nucleotide Accession #: NM_181431
• Tested Species Reactivity: Human
• Gene Symbol: FOXK2
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human 293T
  
  WB Suggested Anti-FOXK2 Antibody
  Titration: 1.0 ug/ml
  Positive Control: 293T Whole CellFOXK2 is supported by BioGPS gene expression data to be expressed in HEK293T