Product Number |
ARP34803_T100 |
Product Page |
www.avivasysbio.com/brd9-antibody-n-terminal-region-arp34803-t100.html |
Name |
BRD9 Antibody - N-terminal region (ARP34803_T100) |
Protein Size (# AA) |
481 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
65980 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Bromodomain containing 9 |
Alias Symbols |
PRO9856, LAVS3040 |
Peptide Sequence |
Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
BRD9 is a member of protein family that contains bromodomain. It is potentially related to cancer. |
Protein Interactions |
CATIP; SUMO2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BRD9 (ARP34803_T100) antibody |
Blocking Peptide |
For anti-BRD9 (ARP34803_T100) antibody is Catalog # AAP34803 (Previous Catalog # AAPP06011) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BRD9 |
Uniprot ID |
Q9H8M2 |
Protein Name |
Bromodomain-containing protein 9 |
Publications |
Middeljans, E. et al. SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes. PLoS One 7, e33834 (2012). 22442726 |
Sample Type Confirmation |
BRD9 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_001009877 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001009877 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
BRD9 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
Image 1 | Mouse, Rat
| Lanes: 1: 60ug mouse melanocytes (melba), 2: 60ug mouse melanoma (B16), 3: 60ug human melanocytes (HFSC), 4: 60ug human melanoma (SK-MEL5), 5: 60ug human melanoma (YUMAC), 6: 60ug rat shwann cell Primary Antibody Dilution: 1:200 Secondary Antibody: Donkey anti-rabbit HPRT Secondary Antibody Dilution: 1:2000 Gene Name: BRD9 Submitted by: Dr. Ivana de la Serna, University of Toledo
|
|
Image 2 | Human Jurkat
| WB Suggested Anti-BRD9 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysateBRD9 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 3 | HeLa Cell Lysate, Human Kidney
| Host: Rabbit Target: BRD9 Positive control (+): HeLa Cell Lysate (HL) Negative control (-): Human Kidney (KI) Antibody concentration: 2.5ug/ml |
|