BRD9 Antibody - N-terminal region (ARP34803_T100)

Data Sheet
 
Product Number ARP34803_T100
Product Page www.avivasysbio.com/brd9-antibody-n-terminal-region-arp34803-t100.html
Name BRD9 Antibody - N-terminal region (ARP34803_T100)
Protein Size (# AA) 481 amino acids
Molecular Weight 53kDa
NCBI Gene Id 65980
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Bromodomain containing 9
Alias Symbols PRO9856, LAVS3040
Peptide Sequence Synthetic peptide located within the following region: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Description of Target BRD9 is a member of protein family that contains bromodomain. It is potentially related to cancer.
Protein Interactions CATIP; SUMO2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BRD9 (ARP34803_T100) antibody
Blocking Peptide For anti-BRD9 (ARP34803_T100) antibody is Catalog # AAP34803 (Previous Catalog # AAPP06011)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BRD9
Uniprot ID Q9H8M2
Protein Name Bromodomain-containing protein 9
Publications

Middeljans, E. et al. SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes. PLoS One 7, e33834 (2012). 22442726

Sample Type Confirmation

BRD9 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001009877
Purification Protein A purified
Nucleotide Accession # NM_001009877
Tested Species Reactivity Human, Mouse
Gene Symbol BRD9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Mouse, Rat
Lanes:
1: 60ug mouse melanocytes (melba), 2: 60ug mouse melanoma (B16), 3: 60ug human melanocytes (HFSC), 4: 60ug human melanoma (SK-MEL5), 5: 60ug human melanoma (YUMAC), 6: 60ug rat shwann cell
Primary Antibody Dilution:
1:200
Secondary Antibody:
Donkey anti-rabbit HPRT
Secondary Antibody Dilution:
1:2000
Gene Name:
BRD9
Submitted by:
Dr. Ivana de la Serna, University of Toledo
Image 2
Human Jurkat
WB Suggested Anti-BRD9 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateBRD9 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 3
HeLa Cell Lysate, Human Kidney
Host: Rabbit
Target: BRD9
Positive control (+): HeLa Cell Lysate (HL)
Negative control (-): Human Kidney (KI)
Antibody concentration: 2.5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com