Product Number |
ARP34703_P050 |
Product Page |
www.avivasysbio.com/rbbp9-antibody-arp34703-p050.html |
Name |
RBBP9 Antibody (ARP34703_P050) |
Protein Size (# AA) |
186 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
10741 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Retinoblastoma binding protein 9 |
Alias Symbols |
BOG, RBBP10 |
Peptide Sequence |
Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chen,J., (2003) J. Hum. Genet. 48 (4), 164-169 |
Description of Target |
RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. |
Protein Interactions |
RB1; TERF2IP; UBC; YRDC; RBL2; RBL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RBBP9 (ARP34703_P050) antibody |
Blocking Peptide |
For anti-RBBP9 (ARP34703_P050) antibody is Catalog # AAP34703 (Previous Catalog # AAPP23651) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP9 |
Uniprot ID |
O75884 |
Protein Name |
Putative hydrolase RBBP9 |
Protein Accession # |
NP_006597 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006606 |
Tested Species Reactivity |
Human |
Gene Symbol |
RBBP9 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IF, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 91% |
Image 1 | Human Corneal Endothelium
| WB Suggested Anti-HNRNPA0 Antibody Titration: 1.25 ug/ml Positive Control: HepG2 Whole Cell |
| Image 2 | Human THP1
| WB Suggested Anti-RBBP9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: THP-1 cell lysate |
|
|