RBBP9 Antibody (ARP34703_P050)

Data Sheet
 
Product Number ARP34703_P050
Product Page www.avivasysbio.com/rbbp9-antibody-arp34703-p050.html
Name RBBP9 Antibody (ARP34703_P050)
Protein Size (# AA) 186 amino acids
Molecular Weight 21kDa
NCBI Gene Id 10741
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Retinoblastoma binding protein 9
Alias Symbols BOG, RBBP10
Peptide Sequence Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chen,J., (2003) J. Hum. Genet. 48 (4), 164-169
Description of Target RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Protein Interactions RB1; TERF2IP; UBC; YRDC; RBL2; RBL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RBBP9 (ARP34703_P050) antibody
Blocking Peptide For anti-RBBP9 (ARP34703_P050) antibody is Catalog # AAP34703 (Previous Catalog # AAPP23651)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP9
Uniprot ID O75884
Protein Name Putative hydrolase RBBP9
Protein Accession # NP_006597
Purification Affinity Purified
Nucleotide Accession # NM_006606
Tested Species Reactivity Human
Gene Symbol RBBP9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IF, WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 91%
Image 1
Human Corneal Endothelium
WB Suggested Anti-HNRNPA0 Antibody
Titration: 1.25 ug/ml
Positive Control: HepG2 Whole Cell
Image 2
Human THP1
WB Suggested Anti-RBBP9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com