MEIS2 Antibody - N-terminal region (ARP34684_T100)

Data Sheet
 
Product Number ARP34684_T100
Product Page www.avivasysbio.com/meis2-antibody-n-terminal-region-arp34684-t100.html
Name MEIS2 Antibody - N-terminal region (ARP34684_T100)
Protein Size (# AA) 477 amino acids
Molecular Weight 52kDa
NCBI Gene Id 4212
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Meis homeobox 2
Alias Symbols MRG1, CPCMR, HsT18361
Peptide Sequence Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yang,Y., et al., (2000) J. Biol. Chem. 275 (27), 20734-20741
Description of Target MEIS2 encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.
Protein Interactions LINC00238; C1orf94; OSGIN1; MEIS2; ANXA1; CRBN; ARNT2; DGCR6; SQSTM1; SOX2; APP; SP1; PBX1; ZNHIT3; TRIM25; HOXA13; HOXA9;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MEIS2 (ARP34684_T100) antibody
Specificity This antibody will recognize both MEIS1 and MEIS2 isoforms
Blocking Peptide For anti-MEIS2 (ARP34684_T100) antibody is Catalog # AAP34684 (Previous Catalog # AAPP05874)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MEIS2
Uniprot ID O14770
Protein Name Homeobox protein Meis2
Publications

Jackson, B. et al. TALE homeodomain proteins regulate site-specific terminal differentiation, LCE genes and epidermal barrier. J. Cell Sci. 124, 1681-90 (2011). 21511732

Protein Accession # NP_733775
Purification Protein A purified
Nucleotide Accession # NM_170675
Tested Species Reactivity Human
Gene Symbol MEIS2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
T-OV
Host: Rabbit
Target Name: MEIS2
Sample Type: T-OV (Tumor-Ovary)
Antibody Dilution: 3.0ug/ml
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com