DMTF1 Antibody - C-terminal region (ARP34602_P050)

Data Sheet
 
Product Number ARP34602_P050
Product Page www.avivasysbio.com/dmtf1-antibody-c-terminal-region-arp34602-p050.html
Name DMTF1 Antibody - C-terminal region (ARP34602_P050)
Protein Size (# AA) 494 amino acids
Molecular Weight 54kDa
NCBI Gene Id 9988
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name cyclin D binding myb like transcription factor 1
Alias Symbols DMP1, DMTF, MRUL, hDMP1
Peptide Sequence Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Interactions SRA1; TP53; ATF7IP; CCND1; CCND3; CCND2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DMTF1 (ARP34602_P050) antibody
Blocking Peptide For anti-DMTF1 (ARP34602_P050) antibody is Catalog # AAP34602 (Previous Catalog # AAPP23615)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
Uniprot ID Q9Y222
Protein Name cyclin-D-binding Myb-like transcription factor 1
Publications

Tooth Germ-Like Construct Transplantation for Whole-Tooth Regeneration: An In Vivo Study in the Miniature Pig. Artif Organs. 40, E39-50 (2016). 26582651

Protein Accession # EAW76962
Purification Affinity Purified
Nucleotide Accession # NM_001142326
Tested Species Reactivity Human
Gene Symbol DMTF1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Image 1
Human HepG2
WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com