| Product Number |
ARP34567_P050-FITC |
| Product Page |
www.avivasysbio.com/kmt5b-antibody-middle-region-fitc-arp34567-p050-fitc.html |
| Name |
KMT5B Antibody - middle region : FITC (ARP34567_P050-FITC) |
| Protein Size (# AA) |
885 amino acids |
| Molecular Weight |
99kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
51111 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
lysine methyltransferase 5B |
| Alias Symbols |
CGI85, MRD51, CGI-85, SUV420H1 |
| Peptide Sequence |
Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Twells,R.C., et al., (2001) Genomics 72 (3), 231-241 |
| Description of Target |
This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
SMARCD1; HIST1H4A; YWHAQ; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-KMT5B (ARP34567_P050-FITC) antibody |
| Blocking Peptide |
For anti-KMT5B (ARP34567_P050-FITC) antibody is Catalog # AAP34567 (Previous Catalog # AAPP05749) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1 |
| Uniprot ID |
Q4FZB7 |
| Protein Name |
histone-lysine N-methyltransferase KMT5B |
| Publications |
Gatta, R. & Mantovani, R. NF-Y substitutes H2A-H2B on active cell-cycle promoters: recruitment of CoREST-KDM1 and fine-tuning of H3 methylations. Nucleic Acids Res. 36, 6592-607 (2008). WB, IHC, IP, ChIP, Human, Rat, Horse, Guinea pig, Mouse, Dog 18940868 Murata, T. et al. Epigenetic histone modification of Epstein-Barr virus BZLF1 promoter during latency and reactivation in Raji cells. J. Virol. 86, 4752-61 (2012). WB, IHC, IP, ChIP, Human, Rat, Horse, Guinea pig, Mouse, Dog 22357272 |
| Purification |
Affinity Purified |
| Gene Symbol |
KMT5B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 93% |
| Image 1 | |
