| Product Number |
ARP34556_P050 |
| Product Page |
www.avivasysbio.com/ergic2-antibody-middle-region-arp34556-p050.html |
| Name |
ERGIC2 Antibody - middle region (ARP34556_P050) |
| Protein Size (# AA) |
377 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
51290 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ERGIC and golgi 2 |
| Alias Symbols |
PTX1, CDA14, Erv41, cd002 |
| Peptide Sequence |
Synthetic peptide located within the following region: TVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yang,Y.F., (2008) Biochim. Biophys. Acta 1784 (2), 312-318 |
| Description of Target |
ERGIC2 belongs to the ERGIC family.It possible play role in transport between endoplasmic reticulum and Golgi. |
| Protein Interactions |
env; UBC; Copa; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ERGIC2 (ARP34556_P050) antibody |
| Blocking Peptide |
For anti-ERGIC2 (ARP34556_P050) antibody is Catalog # AAP34556 (Previous Catalog # AAPP05738) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ERGIC2 |
| Uniprot ID |
Q96RQ1 |
| Protein Name |
Endoplasmic reticulum-Golgi intermediate compartment protein 2 |
| Publications |
Nelson, T. J. & Alkon, D. L. Protection against beta-amyloid-induced apoptosis by peptides interacting with beta-amyloid. J. Biol. Chem. 282, 31238-49 (2007). 17761669 |
| Protein Accession # |
NP_057654 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016570 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ERGIC2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human Lung
 | WB Suggested Anti-ERGIC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung |
|
