ZNF148 Antibody - middle region (ARP34536_P050)

Data Sheet
 
Product Number ARP34536_P050
Product Page www.avivasysbio.com/znf148-antibody-middle-region-arp34536-p050.html
Name ZNF148 Antibody - middle region (ARP34536_P050)
Protein Size (# AA) 794 amino acids
Molecular Weight 89kDa
NCBI Gene Id 7707
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 148
Alias Symbols BERF-1, BFCOL1, GDACCF, ZBP-89, ZFP148, pHZ-52, HT-BETA
Peptide Sequence Synthetic peptide located within the following region: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chupreta,S., (2007) J. Biol. Chem. 282 (50), 36155-36166
Description of Target ZNF148 is involved in transcriptional regulation. ZNF148 represses the transcription of a number of genes including gastrin, stromelysin and enolase. ZNF148 binds to the G-rich box in the enhancer region of these genes.
Protein Interactions CCDC67; CEP70; NUTM2F; GORASP2; GLRX3; TRIM10; SIAH1; KRT31; SUMO1; UBC; NOC4L; ZNF316; TRRAP; KAT2A; EP300; ELAVL1; SUMO2; HDAC1; HDAC3; PTRF; TP53; STAT3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF148 (ARP34536_P050) antibody
Blocking Peptide For anti-ZNF148 (ARP34536_P050) antibody is Catalog # AAP34536 (Previous Catalog # AAPP06008)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF148
Uniprot ID Q9UQR1
Protein Name Zinc finger protein 148
Publications

Hemida, M. G. et al. MicroRNA-203 enhances coxsackievirus B3 replication through targeting zinc finger protein-148. Cell. Mol. Life Sci. 70, 277-91 (2013). 22842794

Protein Accession # NP_068799
Purification Affinity Purified
Nucleotide Accession # NM_021964
Tested Species Reactivity Human
Gene Symbol ZNF148
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Placenta
WB Suggested Anti-ZNF148 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com