ZMYM3 Antibody - N-terminal region (ARP34515_T100)

Data Sheet
 
Product Number ARP34515_T100
Product Page www.avivasysbio.com/zmym3-antibody-n-terminal-region-arp34515-t100.html
Name ZMYM3 Antibody - N-terminal region (ARP34515_T100)
Protein Size (# AA) 1370 amino acids
Molecular Weight 152kDa
NCBI Gene Id 9203
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger, MYM-type 3
Alias Symbols MYM, XFIM, ZNF261, DXS6673E, ZNF198L2
Peptide Sequence Synthetic peptide located within the following region: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Description of Target The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Interactions UBC; SUMO2; GTF2I; RNF2; HDAC6; HDAC1; Dlg4; HDAC2; CDK6; HDAC3; CBX5; WBSCR22; THOC2; WDHD1; TJP2; APP; SIRT7; Dynll1; KDM1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZMYM3 (ARP34515_T100) antibody
Blocking Peptide For anti-ZMYM3 (ARP34515_T100) antibody is Catalog # AAP34515 (Previous Catalog # AAPY00537)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZMYM3
Uniprot ID Q14202
Protein Name Zinc finger MYM-type protein 3
Protein Accession # NP_005087
Purification Protein A purified
Nucleotide Accession # NM_005096
Tested Species Reactivity Human
Gene Symbol ZMYM3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Transfected 293T
WB Suggested Anti-ZMYM3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com