TFB2M Antibody - N-terminal region (ARP34471_T100)

Data Sheet
 
Product Number ARP34471_T100
Product Page www.avivasysbio.com/tfb2m-antibody-n-terminal-region-arp34471-t100.html
Name TFB2M Antibody - N-terminal region (ARP34471_T100)
Protein Size (# AA) 396 amino acids
Molecular Weight 45kDa
NCBI Gene Id 64216
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transcription factor B2, mitochondrial
Alias Symbols Hkp1, mtTFB2
Peptide Sequence Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Falkenberg,M., (2002) Nat. Genet. 31 (3), 289-294
Description of Target TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.
Protein Interactions UBC; FBXO6; C1QBP; CUL3; TFB2M; POLRMT; TFAM; PNP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TFB2M (ARP34471_T100) antibody
Blocking Peptide For anti-TFB2M (ARP34471_T100) antibody is Catalog # AAP34471 (Previous Catalog # AAPY00433)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TFB2M
Uniprot ID Q9H5Q4
Protein Name Dimethyladenosine transferase 2, mitochondrial
Protein Accession # NP_071761
Purification Protein A purified
Nucleotide Accession # NM_022366
Tested Species Reactivity Human
Gene Symbol TFB2M
Predicted Species Reactivity Human, Rat, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Horse: 100%; Human: 100%; Rabbit: 83%; Rat: 85%
Image 1
Human Intestine
Human Intestine
Image 2
Transfected 293T
WB Suggested Anti-TFB2M Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com