| Product Number |
ARP34413_P050 |
| Product Page |
www.avivasysbio.com/prickle3-antibody-c-terminal-region-arp34413-p050.html |
| Name |
PRICKLE3 Antibody - C-terminal region (ARP34413_P050) |
| Protein Size (# AA) |
615 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
4007 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Prickle homolog 3 (Drosophila) |
| Alias Symbols |
Pk3, LMO6, LOAM |
| Peptide Sequence |
Synthetic peptide located within the following region: GAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Olsen,J.V., (2006) Cell 127 (3), 635-648 |
| Description of Target |
LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions.LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions. |
| Protein Interactions |
SULT2B1; TUBGCP3; UBC; Tubg1; Mzt2; TRIM29; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PRICKLE3 (ARP34413_P050) antibody |
| Blocking Peptide |
For anti-PRICKLE3 (ARP34413_P050) antibody is Catalog # AAP34413 (Previous Catalog # AAPP23696) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PRICKLE3 |
| Uniprot ID |
O43900 |
| Protein Name |
Prickle-like protein 3 |
| Protein Accession # |
NP_006141 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006150 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PRICKLE3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 83%; Guinea Pig: 79%; Horse: 83%; Human: 100%; Mouse: 86%; Pig: 91%; Rat: 86% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-PRICKLE3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T |
|
|
