CIAO1 Antibody - middle region (ARP34400_P050)

Data Sheet
 
Product Number ARP34400_P050
Product Page www.avivasysbio.com/ciao1-antibody-middle-region-arp34400-p050.html
Name CIAO1 Antibody - middle region (ARP34400_P050)
Protein Size (# AA) 339 amino acids
Molecular Weight 38kDa
NCBI Gene Id 9391
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cytosolic iron-sulfur protein assembly 1
Alias Symbols CIA1, WDR39
Peptide Sequence Synthetic peptide located within the following region: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Description of Target CIAO1 belongs to the WD repeat CIA1 family. It seems to specifically modulate the transactivation activity of WT1.
Protein Interactions FAM96B; SF1; MEOX1; FAM96A; MMS19; FMNL2; TOE1; DPP9; FMNL3; CTU1; PPIL4; MAK16; WDR75; NSRP1; EEPD1; WDR61; CDC73; UPF3B; NARFL; YAE1D1; TYW1; ELP2; ELP3; UCKL1; CDKAL1; DPP8; ELP6; PAF1; PLEKHA5; PHAX; RTEL1; ELP4; POLA2; ELP5; WDR43; ERP29; GLRX3; CTR9
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CIAO1 (ARP34400_P050) antibody
Blocking Peptide For anti-CIAO1 (ARP34400_P050) antibody is Catalog # AAP34400 (Previous Catalog # AAPY00302)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CIAO1
Uniprot ID O76071
Protein Name Probable cytosolic iron-sulfur protein assembly protein CIAO1
Sample Type Confirmation

CIAO1 is supported by BioGPS gene expression data to be expressed in 721_B, MCF7

Protein Accession # NP_004795
Purification Affinity Purified
Nucleotide Accession # NM_004804
Tested Species Reactivity Human
Gene Symbol CIAO1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%
Image 1
Human Lung Tissue
Rabbit Anti-CIAO1 Antibody
Catalog Number: ARP34400_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasmic in alveolar type I cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human 721_B
WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B
Image 3
Human MCF7
Host: Rabbit
Target Name: CIAO1
Sample Type: MCF7
Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in MCF7
Image 4
Human 721_B
Host: Rabbit
Target Name: CIAO1
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com