COLQ Antibody - N-terminal region (ARP34362_P050)

• Product Number: ARP34362_P050
• Name: COLQ Antibody - N-terminal region (ARP34362_P050)
• Protein Size (# AA): 329 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 8292
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
• Alias Symbols: EAD, CMS5
• Peptide Sequence: Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ishigaki,K., et al., (2003) Neuromuscul. Disord. 13 (3), 236-244
• Description of Target: COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
• Protein Interactions: UBC; MUSK; BCHE; ACHE;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-COLQ (ARP34362_P050) antibody is Catalog # AAP34362 (Previous Catalog # AAPY00137)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COLQ
• Uniprot ID: Q9Y215-8
• Protein Name: Acetylcholinesterase collagenic tail peptide
• Protein Accession #: NP_536805
• Purification: Affinity Purified
• Nucleotide Accession #: NM_080544
• Tested Species Reactivity: Human
• Gene Symbol: COLQ
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
• Image 1: Human HepG2
  
  WB Suggested Anti-COLQ Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 2: Human Adult Placenta
  
  Host: Rabbit
  Target Name: COLQ
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Adult Placenta
  
  Host: Rabbit
  Target Name: COLQ
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml