MED6 Antibody - middle region (ARP34220_P050)

Data Sheet
 
Product Number ARP34220_P050
Product Page www.avivasysbio.com/med6-antibody-middle-region-arp34220-p050.html
Name MED6 Antibody - middle region (ARP34220_P050)
Protein Size (# AA) 246 amino acids
Molecular Weight 28kDa
Subunit 6
NCBI Gene Id 10001
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name mediator complex subunit 6
Alias Symbols ARC33, NY-REN-28
Peptide Sequence Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pavri,R., (2005) Mol. Cell 18 (1), 83-96
Protein Interactions TARDBP; UBC; CDK19; CDK8; MED10; MED23; CCNC; MED19; MED26; FBXW7; MED11; MED28; MED29; MED4; MED12; MED7; MED21; MED1; SMARCA4; BCL6; SUZ12; CUL1; SKP1; CTDP1; MED25; SREBF1; MED15; VDR; OBFC1; MED18; ZC3H13; TADA2A; RARA; PARP1; SMAD3; SMAD2; SMAD1; MED
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MED6 (ARP34220_P050) antibody
Blocking Peptide For anti-MED6 (ARP34220_P050) antibody is Catalog # AAP34220 (Previous Catalog # AAPP05535)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MED6
Uniprot ID O75586
Protein Name mediator of RNA polymerase II transcription subunit 6
Sample Type Confirmation

MED6 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_005457
Purification Affinity Purified
Nucleotide Accession # NM_005466
Tested Species Reactivity Human
Gene Symbol MED6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB, CHIP
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human 721_B
WB Suggested Anti-MED6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateMED6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Image 2
Human Fetal Brain
Host: Rabbit
Target Name: MED6
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Muscle
Host: Rabbit
Target Name: MED6
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml
Image 4
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com