MED6 Antibody - middle region (ARP34219_P050)

Data Sheet
 
Product Number ARP34219_P050
Product Page www.avivasysbio.com/med6-antibody-middle-region-arp34219-p050.html
Name MED6 Antibody - middle region (ARP34219_P050)
Protein Size (# AA) 246 amino acids
Molecular Weight 28kDa
Subunit 6
NCBI Gene Id 10001
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name mediator complex subunit 6
Alias Symbols ARC33, NY-REN-28
Peptide Sequence Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pavri,R., (2005) Mol. Cell 18 (1), 83-96
Protein Interactions TARDBP; UBC; CDK19; CDK8; MED10; MED23; CCNC; MED19; MED26; FBXW7; MED11; MED28; MED29; MED4; MED12; MED7; MED21; MED1; SMARCA4; BCL6; SUZ12; CUL1; SKP1; CTDP1; MED25; SREBF1; MED15; VDR; OBFC1; MED18; ZC3H13; TADA2A; RARA; PARP1; SMAD3; SMAD2; SMAD1; MED
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MED6 (ARP34219_P050) antibody
Blocking Peptide For anti-MED6 (ARP34219_P050) antibody is Catalog # AAP34219 (Previous Catalog # AAPP05534)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MED6
Uniprot ID O75586
Protein Name mediator of RNA polymerase II transcription subunit 6
Protein Accession # NP_005457
Purification Affinity Purified
Nucleotide Accession # NM_005466
Tested Species Reactivity Mouse
Gene Symbol MED6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application CHIP, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%
Image 1
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Image 2
Mouse Testis
Host: Mouse
Target Name: MED6
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
Image 3
Transfected 293T
WB Suggested Anti-MED6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com