| Product Number |
ARP34197_P050 |
| Product Page |
www.avivasysbio.com/egr3-antibody-middle-region-arp34197-p050.html |
| Name |
EGR3 Antibody - middle region (ARP34197_P050) |
| Protein Size (# AA) |
387 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
1960 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Early growth response 3 |
| Alias Symbols |
EGR-3, PILOT |
| Peptide Sequence |
Synthetic peptide located within the following region: ALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yamada,K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (8), 2815-2820 |
| Description of Target |
EGR3 is a probable transcription factor involved in muscle spindle development.The gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the transcriptional regulation of genes in controling biological rhythm. It may also plays a role in muscle development. |
| Protein Interactions |
FASLG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EGR3 (ARP34197_P050) antibody |
| Blocking Peptide |
For anti-EGR3 (ARP34197_P050) antibody is Catalog # AAP34197 (Previous Catalog # AAPP05512) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EGR3 |
| Uniprot ID |
Q06889 |
| Protein Name |
Early growth response protein 3 |
| Protein Accession # |
NP_004421 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004430 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EGR3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Stomach
 | WB Suggested Anti-EGR3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human Stomach |
| | Image 2 | Human Placenta
 | Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-EGR3 antibody (ARP34197_P050) |
|
|
