| Product Number |
ARP34188_P050 |
| Product Page |
www.avivasysbio.com/cops2-antibody-n-terminal-region-arp34188-p050.html |
| Name |
COPS2 Antibody - N-terminal region (ARP34188_P050) |
| Protein Size (# AA) |
443 amino acids |
| Molecular Weight |
52kDa |
| Subunit |
2 |
| NCBI Gene Id |
9318 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) |
| Alias Symbols |
CSN2, SGN2, ALIEN, TRIP15 |
| Peptide Sequence |
Synthetic peptide located within the following region: SDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Leal,J.F., (2008) Oncogene 27 (14), 1961-1970 |
| Description of Target |
COPS2 is an essential component of the COP9 signalosome complex (CSN). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. COPS2 is involved in early stage of neuronal differentiation via its interaction with NIF3L1. |
| Protein Interactions |
UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-COPS2 (ARP34188_P050) antibody |
| Blocking Peptide |
For anti-COPS2 (ARP34188_P050) antibody is Catalog # AAP34188 (Previous Catalog # AAPP05503) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2 |
| Uniprot ID |
P61201 |
| Protein Name |
COP9 signalosome complex subunit 2 |
| Protein Accession # |
NP_004227 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004236 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
COPS2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100% |
| Image 1 | Human liver tissue
 | Rabbit Anti-COPS2 Antibody
Catalog Number: ARP34188_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-COPS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
