| Product Number |
ARP34180_P050 |
| Product Page |
www.avivasysbio.com/pax8-antibody-c-terminal-region-arp34180-p050.html |
| Name |
Pax8 Antibody - C-terminal region (ARP34180_P050) |
| Protein Size (# AA) |
457 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
18510 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paired box gene 8 |
| Alias Symbols |
Pax, Pax-8 |
| Peptide Sequence |
Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development. |
| Protein Interactions |
Jade1; Nkx2-1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Pax8 (ARP34180_P050) antibody |
| Blocking Peptide |
For anti-Pax8 (ARP34180_P050) antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442) |
| Uniprot ID |
Q00288 |
| Protein Name |
Paired box protein Pax-8 |
| Protein Accession # |
NP_035170 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_011040 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Pax8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Pancreas
 | WB Suggested Anti-Pax8 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas |
| | Image 2 | Human thyroid tissue
 | Rabbit Anti-PAX8 Antibody
Catalog Number: ARP34180_P050
Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue
Observed Staining: Nucleus in follicular cells
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
|
