SNAPC3 Antibody - middle region (ARP34173_P050)

Data Sheet
 
Product Number ARP34173_P050
Product Page www.avivasysbio.com/snapc3-antibody-middle-region-arp34173-p050.html
Name SNAPC3 Antibody - middle region (ARP34173_P050)
Protein Size (# AA) 411 amino acids
Molecular Weight 47kDa
Subunit 3
NCBI Gene Id 6619
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Small nuclear RNA activating complex, polypeptide 3, 50kDa
Alias Symbols SNAP50, PTFbeta
Peptide Sequence Synthetic peptide located within the following region: LRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jawdekar,G.W., (2006) J. Biol. Chem. 281 (41), 31050-31060
Description of Target SNAPC3 is part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC3 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. SNAP
Protein Interactions CEP57L1; HSD17B14; UBC; SNAPC2; UBD; SNAPC1; RB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SNAPC3 (ARP34173_P050) antibody
Blocking Peptide For anti-SNAPC3 (ARP34173_P050) antibody is Catalog # AAP34173 (Previous Catalog # AAPP05435)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SNAPC3
Uniprot ID Q92966
Protein Name snRNA-activating protein complex subunit 3
Protein Accession # NP_001034786
Purification Affinity Purified
Nucleotide Accession # NM_001039697
Tested Species Reactivity Human
Gene Symbol SNAPC3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human PANC1
WB Suggested Anti-SNAPC3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com