PTGER3 Antibody - middle region (ARP34099_P050)

• Product Number: ARP34099_P050
• Name: PTGER3 Antibody - middle region (ARP34099_P050)
• Protein Size (# AA): 418 amino acids
• Molecular Weight: 57 kDa
• NCBI Gene Id: 5733
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Prostaglandin E receptor 3 (subtype EP3)
• Alias Symbols: EP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875
• Peptide Sequence: Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Patwardhan,A.M., (2008) J. Dent. Res. 87 (3), 262-266
• Description of Target: The specific function of this protein remains unknown.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.
• Protein Interactions: NOTCH2NL; INCA1; KRTAP10-3; KRTAP10-8; KRTAP10-9; KRTAP10-7; TRIM42; MGAT5B; KRT40; CCDC33; ADAMTSL4; EFEMP2; RGS17; SPRY2; KRT38; RGS20; TCF4; REL; MEOX2; KRT31; CDA; GHRL; MKLN1; PTGER1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-PTGER3 (ARP34099_P050) antibody is Catalog # AAP34099 (Previous Catalog # AAPP05308)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTGER3
• Uniprot ID: B1AK19
• Protein Name: Prostaglandin E receptor 3 (Subtype EP3) EMBL CAI20225.1
• Protein Accession #: NP_942011
• Purification: Affinity Purified
• Nucleotide Accession #: NM_198718
• Tested Species Reactivity: Human
• Gene Symbol: PTGER3
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HT1080
  
  WB Suggested Anti-PTGER3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: HT1080 cell lysate
• Image 2: Human lung, 293T
  
  Host: Rabbit
  Target: PTGER3
  Positive control (+): Human lung (LU)
  Negative control (-): 293T (2T)
  Antibody concentration: 1ug/ml