RGS17 Antibody - C-terminal region (ARP34049_P050)

Data Sheet
 
Product Number ARP34049_P050
Product Page www.avivasysbio.com/rgs17-antibody-c-terminal-region-arp34049-p050.html
Name RGS17 Antibody - C-terminal region (ARP34049_P050)
Protein Size (# AA) 210 amino acids
Molecular Weight 23kDa
NCBI Gene Id 26575
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name regulator of G-protein signaling 17
Alias Symbols RGSZ2, RGS-17, hRGS17
Peptide Sequence Synthetic peptide located within the following region: NRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.
Protein Interactions LCE3C; LCE2A; LCE4A; TBC1D16; DHX37; NUFIP2; PTGER3; OTX1; RPL10A; SMCP; HOXA1; GNAI3; GNAI1; AQP1; ADRB2; RABEP1; RBBP8; UBC; OSTM1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RGS17 (ARP34049_P050) antibody
Blocking Peptide For anti-RGS17 (ARP34049_P050) antibody is Catalog # AAP34049
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RGS17
Uniprot ID Q9UGC6
Protein Name Regulator of G-protein signaling 17
Protein Accession # NP_036551
Purification Affinity Purified
Nucleotide Accession # NM_012419
Tested Species Reactivity Human
Gene Symbol RGS17
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human COLO205 Whole Cell
Host: Rabbit
Target Name: RGS17
Sample Tissue: Human COLO205 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com