Slc17a2 Antibody - middle region (ARP33987_P050)

Data Sheet
 
Product Number ARP33987_P050
Product Page www.avivasysbio.com/slc17a2-antibody-middle-region-arp33987-p050.html
Name Slc17a2 Antibody - middle region (ARP33987_P050)
Protein Size (# AA) 447 amino acids
Molecular Weight 48kDa
NCBI Gene Id 218103
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Solute carrier family 17 (sodium phosphate), member 2
Alias Symbols NP, NPT3, C730032N17Rik
Peptide Sequence Synthetic peptide located within the following region: GFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Slc17a2 (ARP33987_P050) antibody
Blocking Peptide For anti-Slc17a2 (ARP33987_P050) antibody is Catalog # AAP33987
Uniprot ID A6PW34
Protein Name Solute carrier family 17 (Sodium phosphate), member 2 EMBL CAO78029.1
Protein Accession # NP_659085
Purification Affinity Purified
Nucleotide Accession # NM_144836
Tested Species Reactivity Mouse
Gene Symbol Slc17a2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Mouse Kidney
WB Suggested Anti-Slc17a2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com